20210801 20180803 20180328 20210801 IID00171 Transcription factor E2F2 Homo sapiens 437 Q14209 B2R9W1 Q7Z6H1 Transcription activator that binds DNA cooperatively with DP proteins through the E2 recognition site, 5'-TTTC[CG]CGC-3' found in the promoter region of a number of genes whose products are involved in cell cycle regulation or in DNA replication. The DRTF1/E2F complex functions in the control of cell-cycle progression from g1 to s phase. E2F2 binds specifically to RB1 in a cell-cycle dependent manner. Nucleus. SL-0191 unkown DEF box 160 196 0 0 MLQGPRALASAAGQTPKVVPAMSPTELWPSGLSSPQLCPATATYYTPLYPQTAPPAAAPGTCLDATPHGPEGQVVRCLPAGRLPAKRKLDLEGIGRPVVPEFPTPKGKCIRVDGLPSPKTPKSPGEKTRYDTSLGLLTKKFIYLLSESEDGVLDLNWAAEVLDVQKRRIYDITNVLEGIQLIRKKAKNNIQWVGRGMFEDPTRPGKQQQLGQELKELMNTEQALDQLIQSCSLSFKHLTEDKANKRLAYVTYQDIRAVGNFKEQTVIAVKAPPQTRLEVPDRTEDNLQIYLKSTQGPIEVYLCPEEVQEPDSPSEEPLPSTSTLCPSPDSAQPSSSTDPSIMEPTASSVPAPAPTPQQAPPPPSLVPLEATDSLLELPHPLLQQTEDQFLSPTLACSSPLISFSPSLDQDDYLWGLEAGEGISDLFDSYDLGDLLIN 1 1n4mC 410 427 order 1 2 1n4mD 410 427 order 1 3 1n4mE 410 421 order 1 4 1n4mE 422 427 disorder 1 1 1n4m X-RAY 277K 5.5 12502741 C.LEE,J.H.CHANG,H.S.LEE,Y.CHO STRUCTURAL BASIS FOR THE RECOGNITION OF THE E2F TRANSACTIVATION DOMAIN BY THE RETINOBLASTOMA TUMOR SUPPRESSOR 2002 GENES DEV. 16 3199 x-ray 1n4m C 410 427 100 0 x-ray 1n4m D 410 427 100 0 x-ray 1n4m E 410 427 100 1 422 427 1 1n4m_1 2740 Hetero dimer 1n4mC Q14209 IID00171 1n4mA P06400 IID00017 1n4mC-1n4mA 2 1n4m_2 2741 Hetero trimer 1n4mE Q14209 IID00171 1n4mD Q14209 IID00171 1n4mB P06400 IID00017 1n4mD-1n4mB 1n4mE-1n4mB ProS 1 possible 1,2,3 410 427 This region binds to Rb (IID00017). The binding region in Rb has another binding fragment from E1A (IID90003), which is a verfied ProS. 128-192,220-306 1-127,193-219,307-437 506 PF16421 211->304 1.4e-38 E2F transcription factor CC-MB domain hmm pfm 507 PF02319 131->194 5.2e-28 E2F/DP family winged-helix DNA-binding domain hmm pfm 3366 2azeB1 206->306 2.7e-37 hmm scp 3367 1cf7A_ 129->193 8.5e-21 hmm scp 5722 PF02319 158->194 5e-11 E2F/DP family winged-helix DNA-binding domain rps pfm 5723 PF16421 210->303 7e-29 E2F transcription factor CC-MB domain rps pfm 8282 1cf7A 128->192 6e-20 rps scp 8283 2azeB1 205->306 4e-28 rps scp