20210801 20180803 20180328 20210801 IID00171 Transcription factor E2F2 Homo sapiens 437 Q14209 B2R9W1 Q7Z6H1 Transcription activator that binds DNA cooperatively with DP proteins through the E2 recognition site, 5'-TTTC[CG]CGC-3' found in the promoter region of a number of genes whose products are involved in cell cycle regulation or in DNA replication. The DRTF1/E2F complex functions in the control of cell-cycle progression from g1 to s phase. E2F2 binds specifically to RB1 in a cell-cycle dependent manner. Nucleus. SL-0191 unkown DEF box 160 196 0 0 E2F2 E2F2_HUMAN MLQGPRALASAAGQTPKVVPAMSPTELWPSGLSSPQLCPATATYYTPLYPQTAPPAAAPGTCLDATPHGPEGQVVRCLPAGRLPAKRKLDLEGIGRPVVPEFPTPKGKCIRVDGLPSPKTPKSPGEKTRYDTSLGLLTKKFIYLLSESEDGVLDLNWAAEVLDVQKRRIYDITNVLEGIQLIRKKAKNNIQWVGRGMFEDPTRPGKQQQLGQELKELMNTEQALDQLIQSCSLSFKHLTEDKANKRLAYVTYQDIRAVGNFKEQTVIAVKAPPQTRLEVPDRTEDNLQIYLKSTQGPIEVYLCPEEVQEPDSPSEEPLPSTSTLCPSPDSAQPSSSTDPSIMEPTASSVPAPAPTPQQAPPPPSLVPLEATDSLLELPHPLLQQTEDQFLSPTLACSSPLISFSPSLDQDDYLWGLEAGEGISDLFDSYDLGDLLIN 1 1n4mC 410 427 order 1 2 1n4mD 410 427 order 1 3 1n4mE 410 421 order 1 4 1n4mE 422 427 disorder 1 1 1n4m X-RAY 277K 5.5 12502741 C.LEE,J.H.CHANG,H.S.LEE,Y.CHO STRUCTURAL BASIS FOR THE RECOGNITION OF THE E2F TRANSACTIVATION DOMAIN BY THE RETINOBLASTOMA TUMOR SUPPRESSOR 2002 GENES DEV. 16 3199 x-ray 1n4m C 410 427 100 0 x-ray 1n4m D 410 427 100 0 x-ray 1n4m E 410 427 100 1 422 427 1 1n4m_1 2740 Hetero dimer 1n4mC Q14209 IID00171 1n4mA P06400 IID00017 1n4mC-1n4mA 2 1n4m_2 2741 Hetero trimer 1n4mE Q14209 IID00171 1n4mD Q14209 IID00171 1n4mB P06400 IID00017 1n4mD-1n4mB 1n4mE-1n4mB ProS 1 possible 1,2,3 410 427 This region binds to Rb (IID00017). The binding region in Rb has another binding fragment from E1A (IID90003), which is a verfied ProS.
Q14209-1 E2F2/RB1 Structure of Rb tumor suppressor bound to the transactivation domain of E2F-2
P03070-2 LT_SV40/RB1 RETINOBLASTOMA POCKET COMPLEXED WITH SV40 LARGE T ANTIGEN P03255-1 E1A_ADE05/RB1 Structure of the retinoblastoma protein pocket domain in complex with adenovirus E1A CR1 domain P06400-1 RB1/E2F1/TFDP1 Structure of the Rb C-terminal domain bound to an E2F1-DP1 heterodimer P06400-3 RB1/PPP1CA Crystal structure of an Rb C-terminal peptide bound to the catalytic subunit of PP1 128-193,205-305,399-399,401-402,417-417,419-422,424-424 1-127,194-204,306-398,400-400,403-416,418-418,423-423,425-437 129-306,401-437 1-128,307-400 12-28,43-48,60-74,82-94,370-400 39-59,205-217,309-330,343-370