20210801 20180803 20180425 20210801 IID00211 Transcription factor HES-1 Class B basic helix-loop-helix protein 39 Hairy and enhancer of split 1 Hairy homolog Hairy-like protein Homo sapiens 280 Q14469 Q6FHB2 Transcriptional repressor of genes that require a bHLH protein for their transcription. May act as a negative regulator of myogenesis by inhibiting the functions of MYOD1 and ASH1. Binds DNA on N-box motifs: 5'-CACNAG-3' with high affinity and on E-box motifs: 5'-CANNTG-3' with low affinity (By similarity). May play a role in a functional FA core complex response to DNA cross-link damage, being required for the stability and nuclear localization of FA core complex proteins, as well as for FANCD2 monoubiquitination in response to DNA damage. Nucleus. SL-0191 unkown WRPW motif 275 278 0 0 MPADIMEKNSSSPVAATPASVNTTPDKPKTASEHRKSSKPIMEKRRRARINESLSQLKTLILDALKKDSSRHSKLEKADILEMTVKHLRNLQRAQMTAALSTDPSVLGKYRAGFSECMNEVTRFLSTCEGVNTEVRTRLLGHLANCMTQINAMTYPGQPHPALQAPPPPPPGPGGPQHAPFAPPPPLVPIPGGAAPPPGGAPCKLGSQAGEAAKVFGGFQVVPAPDGQFAFLIPNGAFAHSGPVIPVYTSNSGTSVGPNAVSPSSGPSLTADSMWRPWRN 1 155 280 disorder 1 4 2mh3A 27 95 order 3 5 2mh3B 27 95 order 3 6 2mh3A 27 37 high_rmsd 3 7 2mh3B 27 37 high_rmsd 3 1 CD 20816878 Coglievina M, Guarnaccia C, Pintar A, Pongor S. 2010 Biochim Biophys Acta. 1804 2153 3 2mh3 NMR 24403087 M.POPOVIC,H.WIENK,M.COGLIEVINA,R.BOELENS,S.PONGOR,A.PINTAR 2014 PROTEINS 82 537 nmr 2mh3 A 27 95 100 0 nmr 2mh3 B 27 95 100 0 1 2mh3_1 2665 Homo dimer 2mh3B Q14469 IID00211 2mh3A Q14469 IID00211 2mh3B-2mh3A 27-95,105-149 1-26,96-104,150-280 639 PF07527 109->147 3.7e-23 Hairy Orange hmm pfm 640 PF00010 35->92 7.2e-20 Helix-loop-helix DNA-binding domain hmm pfm 3464 2db7A1 99->149 1.2e-18 hmm scp 3465 1hloA_ 25->94 1.4e-15 hmm scp 5834 PF07527 110->147 4e-12 Hairy Orange rps pfm 8381 1a0aA 35->93 8e-11 rps scp 8382 2db7A1 103->149 2e-12 rps scp