20210801 20180803 20180425 20210801 IID00211 Transcription factor HES-1 Class B basic helix-loop-helix protein 39 Hairy and enhancer of split 1 Hairy homolog Hairy-like protein Homo sapiens 280 Q14469 Q6FHB2 Transcriptional repressor of genes that require a bHLH protein for their transcription. May act as a negative regulator of myogenesis by inhibiting the functions of MYOD1 and ASH1. Binds DNA on N-box motifs: 5'-CACNAG-3' with high affinity and on E-box motifs: 5'-CANNTG-3' with low affinity (By similarity). May play a role in a functional FA core complex response to DNA cross-link damage, being required for the stability and nuclear localization of FA core complex proteins, as well as for FANCD2 monoubiquitination in response to DNA damage. Nucleus. SL-0191 unkown WRPW motif 275 278 0 0 HES1 HES1_HUMAN MPADIMEKNSSSPVAATPASVNTTPDKPKTASEHRKSSKPIMEKRRRARINESLSQLKTLILDALKKDSSRHSKLEKADILEMTVKHLRNLQRAQMTAALSTDPSVLGKYRAGFSECMNEVTRFLSTCEGVNTEVRTRLLGHLANCMTQINAMTYPGQPHPALQAPPPPPPGPGGPQHAPFAPPPPLVPIPGGAAPPPGGAPCKLGSQAGEAAKVFGGFQVVPAPDGQFAFLIPNGAFAHSGPVIPVYTSNSGTSVGPNAVSPSSGPSLTADSMWRPWRN 1 155 280 disorder 1 4 2mh3A 27 95 order 3 5 2mh3B 27 95 order 3 6 2mh3A 27 37 high_rmsd 3 7 2mh3B 27 37 high_rmsd 3 1 CD 20816878 Coglievina M, Guarnaccia C, Pintar A, Pongor S. 2010 Biochim Biophys Acta. 1804 2153 3 2mh3 NMR 24403087 M.POPOVIC,H.WIENK,M.COGLIEVINA,R.BOELENS,S.PONGOR,A.PINTAR 2014 PROTEINS 82 537 nmr 2mh3 A 27 95 100 0 nmr 2mh3 B 27 95 100 0 1 2mh3_1 2665 Homo dimer 2mh3B Q14469 IID00211 2mh3A Q14469 IID00211 2mh3B-2mh3A 38-98,104-152,167-171,183-185,218-233,278-278 1-37,99-103,153-166,172-182,186-217,234-277,279-280 53-92,99-148 1-52,149-280 1-7,34-52,215-224,272-280 10-21,156-202