20210801 20180803 20180328 20210801 IID00385 Dr1-associated corepressor Dr1-associated protein 1 Negative cofactor 2-alpha Homo sapiens 205 Q14919 Q13448 The association of the DR1/DRAP1 heterodimer with TBP results in a functional repression of both activated and basal transcription of class II genes. This interaction precludes the formation of a transcription-competent complex by inhibiting the association of TFIIA and/or TFIIB with TBP. Can bind to DNA on its own. Nucleus. SL-0191 unkown 0 0 0 0 DRAP1 NC2A_HUMAN MPSKKKKYNARFPPARIKKIMQTDEEIGKVAAAVPVIISRALELFLESLLKKACQVTQSRNAKTMTTSHLKQCIELEQQFDFLKDLVASVPDMQGDGEDNHMDGDKGARRGRKPGSGGRKNGGMGTKSKDKKLSGTDSEQEDESEDTDTDGEEETSQPPPQASHPSAHFQSPPTPFLPFASTLPLPPAPPGPSAPDEEDEEDYDS 1 1jfiA 1 9 disorder 1 2 1jfiA 10 60 order 1 3 1jfiA 61 63 disorder 1 4 1jfiA 64 75 order 1 5 1jfiA 76 77 disorder 1 1 1jfi X-RAY 293K 5.5 11461703 K.KAMADA,F.SHU,H.CHEN,S.MALIK,G.STELZER,R.G.ROEDER,M.MEISTERERNST,S.K.BURLEY 2001 CELL(CAMBRIDGE,MASS.) 106 71 x-ray 1jfi A 1 77 100 3 1 9 61 63 76 77 1 1jfi_1 2387 Hetero trimer 1jfiB Q01658 IID00206 1jfiA Q14919 IID00385 1jfiC P20226 IID00367 1jfiB-1jfiC 1jfiB-1jfiA 1jfiA-1jfiC 3-4,6-94,172-172,174-175,177-178,184-192,194-195,202-202,204-204 1-2,5-5,95-171,173-173,176-176,179-183,193-193,196-201,203-203,205-205 9-87 1-8,88-205 88-94,149-152,199-205 106-127,134-168,171-195