20210801 20180803 20180425 20210801 IID00521 Protein lin-7 homolog C Mammalian lin-seven protein 3 Vertebrate lin-7 homolog 3 Homo sapiens 197 Q9NUP9 Plays a role in establishing and maintaining the asymmetric distribution of channels and receptors at the plasma membrane of polarized cells. Forms membrane-associated multiprotein complexes that may regulate delivery and recycling of proteins to the correct membrane domains. The tripartite complex composed of LIN7 (LIN7A, LIN7B or LIN7C), CASK and APBA1 associates with the motor protein KIF17 to transport vesicles containing N-methyl-D-aspartate (NMDA) receptor subunit NR2B along microtubules (By similarity). This complex may have the potential to couple synaptic vesicle exocytosis to cell adhesion in brain. Ensures the proper localization of GRIN2B (subunit 2B of the NMDA receptor) to neuronal postsynaptic density and may function in localizing synaptic vesicles at synapses where it is recruited by beta-catenin and cadherin. Required to localize Kir2 channels, GABA transporter (SLC6A12) and EGFR/ERBB1, ERBB2, ERBB3 and ERBB4 to the basolateral membrane of epithelial cells. Cell membrane. SL-0039 unkown Basolateral cell membrane. SL-0026 unkown Cell junction. SL-0038 unkown Cell junction, Synapse, Postsynaptic cell membrane, Postsynaptic density. SL-0466 unkown Cell junction, Tight junction. SL-0265 unkown Cell junction, Synapse, Synaptosome. SL-0261 unkown Kinase interacting site 2 13 N-acetylalanine 2 2 LIN7C LIN7C_HUMAN MAALGEPVRLERDICRAIELLEKLQRSGEVPPQKLQALQRVLQSEFCNAVREVYEHVYETVDISSSPEVRANATAKATVAAFAASEGHSHPRVVELPKTEEGLGFNIMGGKEQNSPIYISRIIPGGIADRHGGLKRGDQLLSVNGVSVEGEHHEKAVELLKAAQGKVKLVVRYTPKVLEEMESRFEKMRSAKRRQQT 1 3lraA 3 64 order 1 1 3lra X-RAY 293K 20702775 X.YANG,X.XIE,L.CHEN,H.ZHOU,Z.WANG,W.ZHAO,R.TIAN,R.ZHANG,C.TIAN,J.LONG,Y.SHEN STRUCTURAL BASIS FOR TANDEM L27 DOMAIN-MEDIATED POLYMERIZATION 2010 FASEB J. 24 4806 x-ray 3lra A 3 64 100 0 1 3lra_1 2585 Monomer monomer 3lraA Q5T2T1 IID00515 3lraA Q12959 IID00513 3lraA Q9NUP9 IID00521 3lraA-3lraA 9-83,90-195 1-8,84-89,196-197 11-47,86-188 1-10,48-85,189-197 7-10,48-66,78-85,189-197 71-84