20210801 20180803 20180425 20210801 IID00579 Proheparin-binding EGF-like growth factor Homo sapiens 208 Q99075 B2R821 Growth factor that mediates its effects via EGFR, ERBB2 and ERBB4. Required for normal cardiac valve formation and normal heart function. Promotes smooth muscle cell proliferation. May be involved in macrophage-mediated cellular proliferation. It is mitogenic for fibroblasts, but not endothelial cells. It is able to bind EGF receptor/EGFR with higher affinity than EGF itself and is a far more potent mitogen for smooth muscle cells than EGF. Also acts as a diphtheria toxin receptor. Secreted, Extracellular space. SL-0112 unkown Cell membrane. SL-0039 unkown 0 0 0 0 MKLLPSVVLKLFLAAVLSALVTGESLERLRRGLAAGTSNPDPPTVSTDQLLPLGGGRDRKVRDLQEADLDLLRVTLSSKPQALATPNKEEHGKRKKKGKGLGKKRDPCLRKYKDFCIHGECKYVKELRAPSCICHPGYHGERCHGLSLPVENRLYTYDHTTILAVVAVVLSSVCLLVIVGLLMFRYHRRGGYDVENEEKVKLGMTNSH 1 2m8sB 185 208 order 2 2 1xdtR 73 106 disorder 1 3 1xdtR 107 147 order 1 4 186 208 disorder 3 1 1xdt X-RAY 7.5) 9659904 G.V.LOUIE,W.YANG,M.E.BOWMAN,S.CHOE 1997 MOL.CELL 1 67 x-ray 1xdt R 73 147 100 1 73 106 1 1xdt_1 3328 Hetero tetramer 1xdtR Q99075 IID00579 1xdtT P00588 1xdtT-1xdtT 1xdtR-1xdtT 2 2m8s NMR 24628338 K.W.HUNG,H.W.HUANG,C.C.CHO,S.C.CHANG,C.YU 2014 BIOCHEMISTRY 53 1935 nmr 2m8s B 185 208 100 0 1 2m8s_1 2649 Hetero dimer 2m8sA Q60739 IID50180 2m8sB Q99075 IID00579 2m8sA-2m8sB 3 NMR 24628338 K.W.HUNG,H.W.HUANG,C.C.CHO,S.C.CHANG,C.YU 2014 BIOCHEMISTRY 53 1935 nmr 186 208 100 1 186 208 ProS 1 verified 1 186 208 4 186 208 107-147,162-184 1-106,148-161,185-208 1672 PF00008 112->142 6.7e-09 EGF-like domain hmm pfm 4259 1moxC_ 104->148 2.7e-16 hmm scp 9150 1xdtR 107->147 7e-15 rps scp