20210801 20180803 20180328 20210801 IID00634 Ubiquitin-conjugating enzyme E2 G1 E2 ubiquitin-conjugating enzyme G1 E217K UBC7 Ubiquitin carrier protein G1 Ubiquitin-protein ligase G1 Homo sapiens 170 P62253 B2R7P2 D3DTK0 Q99462 Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro catalyzes 'Lys-48'-, as well as 'Lys-63'-linked polyubiquitination. May be involved in degradation of muscle-specific proteins. Mediates polyubiquitination of CYP3A4. 0 0 N-acetylmethionine 1 1 N-acetylthreonine; in Ubiquitin-conjugating enzyme E2 G1, N-terminally processed 2 2 MTELQSALLLRRQLAELNKNPVEGFSAGLIDDNDLYRWEVLIIGPPDTLYEGGVFKAHLTFPKDYPLRPPKMKFITEIWHPNVDKNGDVCISILHEPGEDKYGYEKPEERWLPIHTVETIMISVISMLADPNGDSPANVDAAKEWREDRNGEFKRKVARCVRKSQETAFE 1 2awfA 8 97 order 1 2 2awfA 98 106 disorder 1 3 2awfA 107 131 order 1 4 2awfA 132 160 disorder 1 1 2awf X-RAY 298K 7.5 22496338 Y.SHENG,J.H.HONG,R.DOHERTY,T.SRIKUMAR,J.SHLOUSH,G.V.AVVAKUMOV,J.R.WALKER,S.XUE,D.NECULAI,J.W.WAN,S.K.KIM,C.H.ARROWSMITH,B.RAUGHT,S.DHE-PAGANON 2012 MOL CELL PROTEOMICS 11 329 x-ray 2awf A 8 160 100 2 98 106 132 160 1 2awf_1 1811 Monomer monomer 2awfA P62253 IID00634 21-166 1-20,167-170 1789 PF00179 10->160 2.2e-55 Ubiquitin-conjugating enzyme hmm pfm 4347 1pzvA_ 8->164 7e-59 hmm scp 9229 2awfA1 8->131 5e-58 rps scp