20210801 20180803 20180228 20210801 IID00676 Nuclear receptor-binding factor 2 Comodulator of PPAR and RXR Homo sapiens 287 Q96F24 A6PW36 B4DWS0 Q86UR2 Q96NP6 Q9H0S9 Q9H2I2 May modulate transcriptional activation by target nuclear receptors. Can act as transcriptional activator (in vitro). Involved in starvation-induced autophagy probably by its association with PI3K complex I (PI3KC3-C1). However, effects has been described variably. Involved in the induction of starvation-induced autophagy (PubMed:24785657). Stabilzes PI3KC3-C1 assembly and enhances ATG14-linked lipid kinase activity of PIK3C3 (By similarity). Proposed to negatively regulate basal and starvation-induced autophagy and to inhibit PIK3C3 activity by modulating interactions in PI3KC3-C1 (PubMed:25086043). May be involved in autophagosome biogenesis (PubMed:25086043). May play a role in neural progenitor cell survival during differentiation (By similarity). Nucleus. SL-0191 unkown Cytoplasm. SL-0086 unkown Cytoplasmic vesicle. SL-0088 unkown Cytoplasmic vesicle, Autophagosome. SL-0023 unkown Nuclear receptor interaction motif 141 145 Phosphoserine 113 113 Phosphoserine 268 268 NRBF2 NRBF2_HUMAN MEVMEGPLNLAHQQSRRADRLLAAGKYEEAISCHKKAAAYLSEAMKLTQSEQAHLSLELQRDSHMKQLLLIQERWKRAQREERLKAQQNTDKDAAAHLQTSHKPSAEDAEGQSPLSQKYSPSTEKCLPEIQGIFDRDPDTLLYLLQQKSEPAEPCIGSKAPKDDKTIIEEQATKIADLKRHVEFLVAENERLRKENKQLKAEKARLLKGPIEKELDVDADFVETSELWSLPPHAETATASSTWQKFAANTGKAKDIPIPNLPPLDFPSPELPLMELSEDILKGFMNN 1 4zeyA 4 86 order 1 1 4zey X-RAY 293K JOINT CENTER FOR STRUCTURAL GENOMICS (JCSG),PARTNERSHIP FOR NUCLEAR RECEPTOR SIGNALING CODE BIOLOGY(NHRS) TO BE PUBLISHED x-ray 4zey A 4 86 100 0 1 4zey_1 3423 Monomer monomer 4zeyA Q96F24 IID00676 5-96,140-146,148-148,161-208,260-260,262-263,265-266 1-4,97-139,147-147,149-160,209-259,261-261,264-264,267-287 6-74,161-209,259-287 1-5,75-160,210-258 1-5,75-89,107-112,127-160,210-233,245-258