20210801 20180803 20180228 20210801 IID00676 Nuclear receptor-binding factor 2 Comodulator of PPAR and RXR Homo sapiens 287 Q96F24 A6PW36 B4DWS0 Q86UR2 Q96NP6 Q9H0S9 Q9H2I2 Involved in starvation-induced autophagy probably by its association with PI3K complex I (PI3KC3-C1). However, effects has been described variably. Involved in the induction of starvation-induced autophagy (PubMed:24785657). Stabilzes PI3KC3-C1 assembly and enhances ATG14-linked lipid kinase activity of PIK3C3 (By similarity). Proposed to negatively regulate basal and starvation-induced autophagy and to inhibit PIK3C3 activity by modulating interactions in PI3KC3-C1 (PubMed:25086043). May be involved in autophagosome biogenesis (PubMed:25086043). May play a role in neural progenitor cell survival during differentiation. Nucleus. SL-0191 unkown Cytoplasm. SL-0086 unkown Cytoplasmic vesicle. SL-0088 unkown Cytoplasmic vesicle, Autophagosome. SL-0023 unkown Nuclear receptor interaction motif 141 145 Phosphoserine 113 113 Phosphoserine 268 268 MEVMEGPLNLAHQQSRRADRLLAAGKYEEAISCHKKAAAYLSEAMKLTQSEQAHLSLELQRDSHMKQLLLIQERWKRAQREERLKAQQNTDKDAAAHLQTSHKPSAEDAEGQSPLSQKYSPSTEKCLPEIQGIFDRDPDTLLYLLQQKSEPAEPCIGSKAPKDDKTIIEEQATKIADLKRHVEFLVAENERLRKENKQLKAEKARLLKGPIEKELDVDADFVETSELWSLPPHAETATASSTWQKFAANTGKAKDIPIPNLPPLDFPSPELPLMELSEDILKGFMNN 1 4zeyA 4 86 order 1 1 4zey X-RAY 293K JOINT CENTER FOR STRUCTURAL GENOMICS (JCSG),PARTNERSHIP FOR NUCLEAR RECEPTOR SIGNALING CODE BIOLOGY(NHRS) TO BE PUBLISHED x-ray 4zey A 4 86 100 0 1 4zey_1 3423 Monomer monomer 4zeyA Q96F24 IID00676 4-86 1-3,87-166,231-287 167-230 1917 PF08961 90->283 4.1e-106 Nuclear receptor-binding factor 2, autophagy regulator hmm pfm 1918 PF17169 4->86 2.9e-55 MIT domain of nuclear receptor-binding factor 2 hmm pfm 4452 2crbA1 5->84 3.4e-35 hmm scp 6982 PF17169 4->83 1e-18 MIT domain of nuclear receptor-binding factor 2 rps pfm 6983 PF08961 90->283 7e-63 Nuclear receptor-binding factor 2, autophagy regulator rps pfm 9324 4zeyA1 4->86 1e-24 rps scp