20210801 20180803 20180425 20210801 IID00697 Methyl-CpG-binding domain protein 3 Methyl-CpG-binding protein MBD3 Homo sapiens 291 O95983 A8K4B7 D6W5Z2 Q6PIL9 Q6PJZ9 Q86XF4 Acts as transcriptional repressor and plays a role in gene silencing. Does not bind to DNA by itself (PubMed:12124384). Binds to DNA with a preference for sites containing methylated CpG dinucleotides (in vitro). Binds to a lesser degree DNA containing unmethylated CpG dinucleotides (PubMed:24307175). Recruits histone deacetylases and DNA methyltransferases. Nucleus. SL-0191 unkown Cytoplasm. SL-0086 unkown 0 0 Phosphoserine 56 56 Phosphoserine 85 85 Phosphoserine 144 144 MBD3 MBD3_HUMAN MERKRWECPALPQGWEREEVPRRSGLSAGHRDVFYYSPSGKKFRSKPQLARYLGGSMDLSTFDFRTGKMLMSKMNKSRQRVRYDSSNQVKGKPDLNTALPVRQTASIFKQPVTKITNHPSNKVKSDPQKAVDQPRQLFWEKKLSGLNAFDIAEELVKTMDLPKGLQGVGPGCTDETLLSAIASALHTSTMPITGQLSAAVEKNPGVWLNTTQPLCKAFMVTDEDIRKQEELVQQVRKRLEEALMADMLAHVEELARDGEAPLDKACAEDDDEEDEEEEEEEPDPDPEMEHV 1 2mb7A 1 70 order 1 2 2mb7A 1 1 high_rmsd 1 3 2mb7A 24 26 high_rmsd 1 1 2mb7 NMR 24307175 J.M.CRAMER,J.N.SCARSDALE,N.M.WALAVALKAR,W.A.BUCHWALD,G.D.GINDER,D.C.WILLIAMS PROBING THE DYNAMIC DISTRIBUTION OF BOUND STATES FOR METHYLCYTOSINE-BINDING DOMAINS ON DNA. 2014 J.BIOL.CHEM. 289 1294 nmr 2mb7 A 1 70 100 0 1 2mb7_1 2653 Monomer monomer 2mb7A O95983 IID00697
Q13330-1 MTA1/HDAC1 The structure of HDAC1 in complex with the dimeric ELM2-SANT domain of MTA1 from the NuRD complex 3-70,105-108,110-110,113-113,116-116,120-121,132-257 1-2,71-104,109-109,111-112,114-115,117-119,122-131,258-291 5-73,145-148,198-248 1-4,74-144,149-197,249-291 1-4,74-99,109-117,123-144,149-185,249-272,283-291 268-287