20250201 IID00757 Peptidyl-prolyl cis-trans isomerase H Rotamase H Small nuclear ribonucleoprotein particle-specific cyclophilin H U-snRNP-associated cyclophilin SnuCyp-20 Homo sapiens 177 O43447 A6NNE7 PPIase that catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and may therefore assist protein folding (PubMed:20676357). Participates in pre-mRNA splicing. May play a role in the assembly of the U4/U5/U6 tri-snRNP complex, one of the building blocks of the spliceosome. May act as a chaperone. Nucleus. SL-0191 unkown 0 0 N-acetylalanine 2 2 PPIH Peptidyl-prolyl cis-trans isomer MAVANSSPVNPVVFFDVSIGGQEVGRMKIELFADVVPKTAENFRQFCTGEFRKDGVPIGYKGSTFHRVIKDFMIQGGDFVNGDGTGVASIYRGPFADENFKLRHSAPGLLSMANSGPSTNGCQFFITCSKCDWLDGKHVVFGKIIDGLLVMRKIENVPTGPNNKPKLPVVISQCGEM 1 1mzwA 1 4 disorder 1 2 1mzwA 5 177 order 1 3 1qoiA 1 4 disorder 2 4 1qoiA 5 177 order 2 1 1mzw X-RAY 294.0K 6.5 12875835 U.REIDT,M.C.WAHL,D.FASSHAUER,D.S.HOROWITZ,R.LUEHRMANN,R.FICNER 2003 J.MOL.BIOL. 331 45 x-ray 1mzw A 1 177 100 1 1 4 1 1mzw_1 3576 Hetero dimer 1mzwB O43172 IID00754 1mzwA O43447 IID00757 1mzwB-1mzwA 2 1qoi X-RAY 8.5 10713041 U.REIDT,K.REUTER,T.ACHSEL,D.INGELFINGER,R.LUEHRMANN,R.FICNER 2000 J.BIOL.CHEM. 275 7439 x-ray 1qoi A 1 177 100 1 1 4 1 1qoi_1 3828 Monomer monomer 1qoiA O43447 IID00757 5-177 1-4 9-159,165-177 1-8,160-164 160-164