20250201 IID00819 DNA-binding protein inhibitor ID-2 Class B basic helix-loop-helix protein 26 Inhibitor of DNA binding 2 Inhibitor of differentiation 2 Homo sapiens 134 Q02363 Transcriptional regulator (lacking a basic DNA binding domain) which negatively regulates the basic helix-loop-helix (bHLH) transcription factors by forming heterodimers and inhibiting their DNA binding and transcriptional activity. Implicated in regulating a variety of cellular processes, including cellular growth, senescence, differentiation, apoptosis, angiogenesis, and neoplastic transformation. Inhibits skeletal muscle and cardiac myocyte differentiation. Regulates the circadian clock by repressing the transcriptional activator activity of the CLOCK-BMAL1 heterodimer. Restricts the CLOCK and BMAL1 localization to the cytoplasm. Plays a role in both the input and output pathways of the circadian clock: in the input component, is involved in modulating the magnitude of photic entrainment and in the output component, contributes to the regulation of a variety of liver clock-controlled genes involved in lipid metabolism. Nucleus. SL-0191 unkown Nuclear export signal 106 115 Phosphoserine 14 14 Phosphoserine 25 25 ID2 DNA-binding protein inhibitor ID MKAFSPVRSVRKNSLSDHSLGISRSKTPVDDPMSLLYNMNDCYSKLKELVPSIPQNKKVSKMEILQHVIDYILDLQIALDSHPTIVSLHHQRPGQNQASRTPLTTLNTDISILSLQASEFPSELMSNDSKALCG 1 4ayaA 1 29 disorder 1 2 4ayaA 30 82 order 1 3 4ayaB 1 34 disorder 1 4 4ayaB 35 82 order 1 1 4aya X-RAY 23119064 M.V.WONG,S.JIANG,P.PALASINGAM,P.R.KOLATKAR 2012 PLOS ONE 7 48591 x-ray 4aya A 1 82 100 1 1 29 x-ray 4aya B 1 82 100 1 1 34 1 4aya_1 2622 Homo dimer 4ayaB Q02363 IID00819 4ayaA Q02363 IID00819 4ayaB-4ayaA 3-4,6-6,8-8,33-82 1-2,5-5,7-7,9-32,83-134 30-83 1-29,84-134 1-9,15-29,100-115,129-134