20250201 20180803 20180328 20250201 IID00846 General transcription factor IIH subunit 5 General transcription factor IIH polypeptide 5 TFB5 ortholog TFIIH basal transcription factor complex TTD-A subunit TFIIH subunit p8 Homo sapiens 71 Q6ZYL4 Q0P5V8 Component of the general transcription and DNA repair factor IIH (TFIIH) core complex, which is involved in general and transcription-coupled nucleotide excision repair (NER) of damaged DNA and, when complexed to CAK, in RNA transcription by RNA polymerase II. In NER, TFIIH acts by opening DNA around the lesion to allow the excision of the damaged oligonucleotide and its replacement by a new DNA fragment. In transcription, TFIIH has an essential role in transcription initiation. When the pre-initiation complex (PIC) has been established, TFIIH is required for promoter opening and promoter escape. Phosphorylation of the C-terminal tail (CTD) of the largest subunit of RNA polymerase II by the kinase module CAK controls the initiation of transcription. Necessary for the stability of the TFIIH complex and for the presence of normal levels of TFIIH in the cell. Cytoplasm, Perinuclear region. SL-0198 unkown Nucleus. SL-0191 unkown 0 0 Phosphothreonine 69 69 GTF2H5 General transcription factor IIH MVNVLKGVLIECDPAMKQFLLYLDESNALGKKFIIQDIDDTHVFVIAELVNVLQERVGELMDQNAFSLTQK 1 2jnjA 1 71 order 1 2 2jnjB 1 71 order 1 4 1ydlA 3 71 order 2 5 2jnjB 65 71 high_rmsd 1 6 2jnjA 65 71 high_rmsd 1 1 2jnj NMR 17350038 M.VITORINO,F.COIN,O.ZLOBINSKAYA,R.A.ATKINSON,D.MORAS,J.M.EGLY,A.POTERSZMAN,B.KIEFFER 2007 J.MOL.BIOL. 368 473 nmr 2jnj A 1 71 100 0 nmr 2jnj B 1 71 100 0 1 2jnj 5386 Homo dimer 2jnjB Q6ZYL4 IID00846 2jnjA Q6ZYL4 IID00846 2jnjB-2jnjA 2 1ydl X-RAY 293K 7.5 F.FOROUHAR,W.EDSTROM,R.XIAO,T.B.ACTON,G.T.MONTELIONE,L.TONG,J.F.HUNT TO BE PUBLISHED x-ray 1ydl A 3 71 94 0 1 1ydl_1 4259 Monomer monomer 1ydlA Q6ZYL4 IID00846

P23025-1 XPA/ERCC1 Q01831-2 XPC/GTF2H1 6-25,32-56,59-59,62-62 1-5,26-31,57-58,60-61,63-71 1-67 68-71 68-71