20250201 IID00872 Cell cycle regulator of non-homologous end joining Modulator of retrovirus infection homolog Homo sapiens 157 Q9BWK5 A0A024R780 A0A087WWQ8 Q6NWZ4 Q6ZNR5 Cell-cycle-specific regulator of classical non-homologous end joining (NHEJ) of DNA double-strand break (DSB) repair, which can act both as an activator or inhibitor of NHEJ, depending on the cell cycle phase (PubMed:24610814, PubMed:28959974). Acts as a regulator of DNA repair pathway choice by specifically inhibiting classical NHEJ during the S and G2 phases, thereby promoting error-free repair by homologous recombination during cell cycle phases when sister chromatids are present (PubMed:28959974). Preferentially protects single-stranded overhangs at break sites by inhibiting classical NHEJ, thereby creating a local environment that favors homologous recombination (PubMed:28959974). Acts via interaction with XRCC5/Ku80 and XRCC6/Ku70 (PubMed:28959974). In contrast, acts as an activator of NHEJ during G1 phase of the cell cycle: promotes classical NHEJ in G1 phase cells via multivalent interactions that increase the affinity of DNA damage response proteins for DSB-associated chromatin. Also involved in immunoglobulin V(D)J recombination (By similarity). May also act as an indirect regulator of proteasome (By similarity). Chromosome. SL-0468 unkown Nucleus. SL-0191 unkown KBM 1 21 XLM 147 157 N-acetylmethionine 1 1 CYREN Cell cycle regulator of non-homo METLQSETKTRVLPSWLTAQVATKNVAPMKAPKRMRMAAVPVAAARLPATRTVYCMNEAEIVDVALGILIESRKQEKACEQPALAGADNPEHSPPCSVSPHTSSGSSSEEEDSGKQALAPGLSPSQRPGGSSSACSRSPEEEEEEDVLKYVREIFFS 1 6tyuB 6 8 disorder 1 2 6tyuB 9 19 order 1 3 6tyuB 20 21 disorder 1 1 6tyu X-RAY 295K 31733588 K.KIM,J.MIN,T.W.KIRBY,S.A.GABEL,L.C.PEDERSEN,R.E.LONDON 2019 DNA REPAIR (AMST.) 85 02739 x-ray 6tyu B 6 21 100 2 6 8 20 21 1 6tyu 6495 Hetero dimer 6tyuA Q6DDS9 6tyuB Q9BWK5 IID00872 6tyuA-6tyuB 9-19,46-76,110-110,146-157 1-8,20-45,77-109,111-145 50-54 1-49,55-157 7-19,44-49,55-75,145-157 34-52,97-113,140-145