20250201 IID00894 Aurora kinase C Aurora 3 Aurora/IPL1-related kinase 3 Aurora/IPL1/Eg2 protein 2 Serine/threonine-protein kinase 13 Serine/threonine-protein kinase aurora-C Homo sapiens 309 Q9UQB9 O60681 O75442 Q6AZY8 Q6DLZ0 Q9UPK5 Serine/threonine-protein kinase component of the chromosomal passenger complex (CPC), a complex that acts as a key regulator of mitosis. The CPC complex has essential functions at the centromere in ensuring correct chromosome alignment and segregation and is required for chromatin-induced microtubule stabilization and spindle assembly. Also plays a role in meiosis and more particularly in spermatogenesis. Has redundant cellular functions with AURKB and can rescue an AURKB knockdown. Like AURKB, AURKC phosphorylates histone H3 at 'Ser-10' and 'Ser-28'. AURKC phosphorylates the CPC complex subunits BIRC5/survivin and INCENP leading to increased AURKC activity. Phosphorylates TACC1, another protein involved in cell division, at 'Ser-228'. Cytoplasm. SL-0086 unkown Cytoplasm, P-body. SL-0230 reported 0 0 Phosphothreonine; by PKA 198 198 AURKC Aurora kinase C MSSPRAVVQLGKAQPAGEELATANQTAQQPSSPAMRRLTVDDFEIGRPLGKGKFGNVYLARLKESHFIVALKVLFKSQIEKEGLEHQLRREIEIQAHLQHPNILRLYNYFHDARRVYLILEYAPRGELYKELQKSEKLDEQRTATIIEELADALTYCHDKKVIHRDIKPENLLLGFRGEVKIADFGWSVHTPSLRRKTMCGTLDYLPPEMIEGRTYDEKVDLWCIGVLCYELLVGYPPFESASHSETYRRILKVDVRFPLSMPLGARDLISRLLRYQPLERLPLAQILKHPWVQAHSRRVLPPCAQMAS 1 6gr9A 36 36 disorder 2 2 6gr9A 37 305 order 2 3 6gr8A 36 303 order 1 4 6gr8A 304 305 disorder 1 1 6gr8 X-RAY 277K 7.5 31320618 Abdul Azeez KR, Chatterjee S, Yu C, Golub TR, Sobott F, Elkins JM Structural mechanism of synergistic activation of Aurora kinase B/C by phosphorylated INCENP 2019 Nat Commun. 10 3166 x-ray 6gr8 A 36 305 99 1 304 305 1 6gr8 2330 Hetero dimer 6gr8B Q9NQS7 IID00224 6gr8A Q9UQB9 IID00894 6gr8B-6gr8A 2 6gr9 X-RAY 277K 7.5 31320618 Abdul Azeez KR, Chatterjee S, Yu C, Golub TR, Sobott F, Elkins JM Structural mechanism of synergistic activation of Aurora kinase B/C by phosphorylated INCENP 2019 Nat Commun. 10 3166 x-ray 6gr9 A 36 305 99 1 36 36 1 6gr9 2330 Hetero dimer 6gr9B Q9NQS7 IID00224 6gr9A Q9UQB9 IID00894 6gr9B-6gr9A
Q9UQB9-1 AURKC/INCENP Human AURKC INCENP complex bound to BRD-7880
36-185,203-304 1-35,186-202,305-309 35-302 1-34,303-309