20250201 IID00895 Charged multivesicular body protein 2b CHMP2.5 Chromatin-modifying protein 2b Vacuolar protein sorting-associated protein 2-2 Homo sapiens 213 Q9UQN3 B4DJG8 Q53HC7 Q9Y4U6 Probable core component of the endosomal sorting required for transport complex III (ESCRT-III) which is involved in multivesicular bodies (MVBs) formation and sorting of endosomal cargo proteins into MVBs. MVBs contain intraluminal vesicles (ILVs) that are generated by invagination and scission from the limiting membrane of the endosome and mostly are delivered to lysosomes enabling degradation of membrane proteins, such as stimulated growth factor receptors, lysosomal enzymes and lipids. The MVB pathway appears to require the sequential function of ESCRT-O, -I,-II and -III complexes. ESCRT-III proteins mostly dissociate from the invaginating membrane before the ILV is released. The ESCRT machinery also functions in topologically equivalent membrane fission events, such as the terminal stages of cytokinesis and the budding of enveloped viruses (HIV-1 and other lentiviruses). ESCRT-III proteins are believed to mediate the necessary vesicle extrusion and/or membrane fission activities, possibly in conjunction with the AAA ATPase VPS4. Nucleus. SL-0191 unkown MIT-interacting motif 201 211 N-acetylalanine 2 2 Phosphoserine 199 199 CHMP2B Charged multivesicular body prot MASLFKKKTVDDVIKEQNRELRGTQRAIIRDRAALEKQEKQLELEIKKMAKIGNKEACKVLAKQLVHLRKQKTRTFAVSSKVTSMSTQTKVMNSQMKMAGAMSTTAKTMQAVNKKMDPQKTLQTMQNFQKENMKMEMTEEMINDTLDDIFDGSDDEEESQDIVNQVLDEIGIEISGKMAKAPSAARSLPSASTSKATISDEEIERQLKALGVD 1 2jqkB 195 199 disorder 1 2 2jqkB 200 213 order 1 3 2jqkB 213 213 high_rmsd 1 1 2jqk NMR 17928862 M.D.STUCHELL-BRERETON,J.J.SKALICKY,C.KIEFFER,M.A.KARREN,S.GHAFFARIAN,W.I.SUNDQUIST 2007 NATURE 449 740 nmr 2jqk B 195 213 100 1 195 199 1 2jqk 5396 Hetero dimer 2jqkB Q9UQN3 IID00895 2jqkA O75351 IID00760 2jqkB-2jqkA ProS 1 possible 2 200 213 Same region of the homolog (Q9Y3E7, CHMP3) is disordered in the free state (PubMed=21827950).

O75351-1 VPS4B/CHMP2B 7-135,161-161,164-171,200-210 1-6,136-160,162-163,172-199,211-213 14-88 1-13,89-213 5-13,89-148,159-179,201-213 35-48,130-141,179-194