20250201 20180803 20180425 20250201 IID50036 Tumor suppressor ARF Alternative reading frame Cyclin-dependent kinase inhibitor 2A p19ARF Mus musculus 169 Q64364 Q4U255 Q9QXC7 Q9R051 Capable of inducing cell cycle arrest in G1 and G2 phases. Acts as a tumor suppressor. Binds to MDM2 and blocks its nucleocytoplasmic shuttling by sequestering it in the nucleolus. This inhibits the oncogenic action of MDM2 by blocking MDM2-induced degradation of p53 and enhancing p53-dependent transactivation and apoptosis. Also induces G2 arrest and apoptosis in a p53-independent manner by preventing the activation of cyclin B1/CDC2 complexes. Binds to BCL6 and down-regulates BCL6-induced transcriptional repression. Binds to E2F1 and MYC and blocks their transcriptional activator activity but has no effect on MYC transcriptional repression. Binds to TOP1/TOPOI and stimulates its activity. This complex binds to rRNA gene promoters and may play a role in rRNA transcription and/or maturation. Interacts with NPM1/B23 and promotes its polyubiquitination and degradation, thus inhibiting rRNA processing. Interacts with COMMD1 and promotes its 'Lys63'-linked polyubiquitination (By similarity). Interacts with UBE2I/UBC9 and enhances sumoylation of a number of its binding partners including MDM2 and E2F1. Binds to HUWE1 and represses its ubiquitin ligase activity. May play a role in controlling cell proliferation and apoptosis during mammary gland development. Isoform smARF may be involved in regulation of autophagy and caspase-independent cell death; the short-lived mitochondrial isoform is stabilized by C1QBP. Cytoplasm. SL-0086 unkown 0 0 0 0 Cdkn2a Tumor suppressor ARF MGRRFLVTVRIQRAGRPLQERVFLVKFVRSRRPRTASCALAFVNMLLRLERILRRGPHRNPGPGDDDGQRSRSSSSAQLRCRFELRGPHYLLPPGARRSAGRLPGHAGGAARVRGSAGCARCLGSPAARLGPRAGTSRHRAIFAFRWVLFVFRWVVFVYRWERRPDRRA 1 1hn3A 1 37 order 1 2 1 37 disorder 2 1 1hn3 NMR 11327858 E.L.DIGIAMMARINO,I.FILIPPOV,J.D.WEBER,B.BOTHNER,R.W.KRIWACKI 2001 BIOCHEMISTRY 40 2379 nmr 1hn3 A 1 37 100 0 1 1hn3 5212 Monomer monomer 1hn3A Q64364 IID50036 2 NMR 11327858 E.L.DIGIAMMARINO,I.FILIPPOV,J.D.WEBER,B.BOTHNER,R.W.KRIWACKI 2001 BIOCHEMISTRY 40 2379 ProS 1 verified 1 1 37 2 1 37 The structure in this region appeares under TFE. However, this region interacts with a disorder region (210-304) in MDM2 (IID00163) by forming a beta-sheet.(PubMed=11718560) 15-15,17-19,44-48,51-51,142-157 1-14,16-16,20-43,49-50,52-141,158-169 1-31,38-43,139-165 32-37,44-138,166-169 32-37,44-50,62-71,79-108,116-138,166-169 70-76,105-121,143-164