20250201 20180803 20180328 20250201 IID50191 Dual specificity mitogen-activated protein kinase kinase 3 MAPK/ERK kinase 3 Mus musculus 347 O09110 P97293 Q91VX1 Dual specificity kinase. Is activated by cytokines and environmental stress in vivo. Catalyzes the concomitant phosphorylation of a threonine and a tyrosine residue in the MAP kinase p38. Part of a signaling cascade that begins with the activation of the adrenergic receptor ADRA1B and leads to the activation of MAPK14. 0 0 N-acetylmethionine 1 1 Phosphoserine 3 3 Phosphoserine 218 218 Phosphothreonine 222 222 Map2k3 Dual specificity mitogen-activat MESPAASPPASLPQTKGKSKRKKDLRISCVSKPPVSNPTPPRNLDSRTFITIGDRNFEVEADDLVTISELGRGAYGVVEKVRHAQSGTIMAVKRIRATVNTQEQKRLLMDLDINMRTVDCFYTVTFYGALFREGDVWICMELMDTSLDKFYRKVLEKNMKIPEDILGEIAVSIVRALEHLHSKLSVIHRDVKPSNVLINKEGHVKMCDFGISGYLVDSVAKTMDAGCKPYMAPERINPELNQKGYNVKSDVWSLGITMIEMAILRFPYESWGTPFQQLKQVVEEPSPQLPADQFSPEFVDFTSQCLRKNPAERMSYLELMEHPFFTLHKTKKTDIAAFVKEILGEDS 1 1lezB 16 21 disorder 1 2 1lezB 22 29 order 1 3 1lezB 30 32 disorder 1 1 1lez X-RAY 289K 7 12086621 C.I.CHANG,B.E.XU,R.AKELLA,M.H.COBB,E.J.GOLDSMITH CRYSTAL STRUCTURES OF MAP KINASE P38 COMPLEXED TO THE DOCKING SITES ON ITS NUCLEAR SUBSTRATE MEF2A AND ACTIVATOR MKK3B. 2002 MOL.CELL 9 1241 x-ray 1lez B 16 32 94 2 16 21 30 32 1 1lez_1 3402 Hetero dimer 1lezA P47811 IID50045 1lezB O09110 IID50191 1lezA-1lezB ProS 1 predicted 2 22 29 The unbound state of this region is deduced to be disordered based on the results of prediction tools (DICHOT, Mobi, d2p2 etc). 47-73,75-97,101-211,214-214,228-237,239-239,246-271,273-345 1-46,74-74,98-100,212-213,215-227,238-238,240-245,272-272,346-347 43-347 1-42 21-28 3-11