20210801 20180803 20180328 20210801 IID50234 EP300-interacting inhibitor of differentiation 1 CREBBP/EP300 inhibitory protein 1 E1A-like inhibitor of differentiation 1 Mus musculus 169 Q9DCR4 Q3T9D1 Q8BP25 Q9CQ17 Q9CYM0 Interacts with RB1 and EP300 and acts as a repressor of MYOD1 transactivation. Inhibits EP300 and CBP histone acetyltransferase activity. May be involved in coupling cell cycle exit to the transcriptional activation of genes required for cellular differentiation. May act as a candidate coinhibitory factor for NR0B2 that can be directly linked to transcription inhibitory mechanisms. Nucleus. SL-0191 unkown LXCXE motif 150 154 0 0 Eid1 EID1_MOUSE MAEMAELCELYEESNELQMDVLPGEGYMEVGRGARGPAPEEGPMEEEAGPAAARAQRGLFPEAGADLEGDEFDDWEDDYEFPEEERWSGAMHRVSAALEEANKVFLRTARAGDALDGGFQARCEKSPFDQLAFIEELFSLMVVNRLTEELGCDEIIDRELMLTREEETT 1 4nufP 91 106 order 1 1 4nuf X-RAY 298K 9.5 24379397 X.ZHI,X.E.ZHOU,Y.HE,C.ZECHNER,K.M.SUINO-POWELL,S.A.KLIEWER,K.MELCHER,D.J.MANGELSDORF,H.E.XU STRUCTURAL INSIGHTS INTO GENE REPRESSION BY THE ORPHAN NUCLEAR RECEPTOR SHP. 2014 PROC.NATL.ACAD.SCI.USA 111 839 x-ray 4nuf P 91 106 100 0 1 4nuf_1 2803 Hetero dimer 4nufP Q9DCR4 IID50234 4nufA Q62227 IID50230 4nufA P0AEX9 IID90020 4nufA-4nufA 4nufP-4nufA 4-5,93-93,95-107,126-150 1-3,6-92,94-94,108-125,151-169 81-166 1-80,167-169 4-16,21-26,58-80 31-58,66-85,158-169