20210801 20180803 20180328 20210801 IID50292 Steroid receptor RNA activator 1 Steroid receptor RNA activator protein Mus musculus 232 Q80VJ2 E9QM44 Q8R0S3 Q9CWU7 Q9D973 Functional RNA which acts as a transcriptional coactivator that selectively enhances steroid receptor-mediated transactivation ligand-independently through a mechanism involving the modulating N-terminal domain (AF-1) of steroid receptors. Also mediates transcriptional coactivation of steroid receptors ligand-dependently through the steroid-binding domain (AF-2). Enhances cellular proliferation and differentiation and promotes apoptosis in vivo. May play a role in tumorigenesis. 0 0 Phosphoserine 60 60 MMRCPAGGAEVEMAELYVKPGNKERGWNDPPQFSYGLQTQTGGPKRTPLTKRVAAPQDGSPRAPETSGPPPVDHPPPSSKASRPPPMGSCPATGVEPPSSPVIESETLIEDVLRPLEQALEDCHGHTKKQVCDDISRRLALLREQWAGGKLSIPVKKRMALLVQELLHHQWDAADDIHRSLMVDHVTEVSQWMVGVKRLIAEKKSLSSEETKEEKFTVEPENQTIPGFQQPS 2 2yruA 102 206 order 1 3 2yruA 102 104 high_rmsd 1 1 2yru NMR N.NAMEKI,K.SAITO,S.KOSHIBA,T.KIGAWA,S.YOKOYAMA TO BE PUBLISHED nmr 2yru A 102 206 100 0 1 2yru 3991 Monomer monomer 2yruA Q80VJ2 IID50292 99-201 1-98,202-232 2849 PF07304 74->215 5e-72 Steroid receptor RNA activator (SRA1) hmm pfm 7792 PF07304 70->205 3e-29 Steroid receptor RNA activator (SRA1) rps pfm