20210801 20180803 20180328 20210801 IID50292 Steroid receptor RNA activator 1 Steroid receptor RNA activator protein Mus musculus 232 Q80VJ2 E9QM44 Q8R0S3 Q9CWU7 Q9D973 Functional RNA which acts as a transcriptional coactivator that selectively enhances steroid receptor-mediated transactivation ligand-independently through a mechanism involving the modulating N-terminal domain (AF-1) of steroid receptors. Also mediates transcriptional coactivation of steroid receptors ligand-dependently through the steroid-binding domain (AF-2). Enhances cellular proliferation and differentiation and promotes apoptosis in vivo. May play a role in tumorigenesis (By similarity). 0 0 Phosphoserine 60 60 Sra1 SRA1_MOUSE MMRCPAGGAEVEMAELYVKPGNKERGWNDPPQFSYGLQTQTGGPKRTPLTKRVAAPQDGSPRAPETSGPPPVDHPPPSSKASRPPPMGSCPATGVEPPSSPVIESETLIEDVLRPLEQALEDCHGHTKKQVCDDISRRLALLREQWAGGKLSIPVKKRMALLVQELLHHQWDAADDIHRSLMVDHVTEVSQWMVGVKRLIAEKKSLSSEETKEEKFTVEPENQTIPGFQQPS 2 2yruA 102 206 order 1 3 2yruA 102 104 high_rmsd 1 1 2yru NMR N.NAMEKI,K.SAITO,S.KOSHIBA,T.KIGAWA,S.YOKOYAMA TO BE PUBLISHED nmr 2yru A 102 206 100 0 1 2yru 3991 Monomer monomer 2yruA Q80VJ2 IID50292 26-32,75-76,84-84,106-211 1-25,33-74,77-83,85-105,212-232 93-191 1-92,192-220 1-22,212-220 57-74,190-203