20210801 20180803 20180328 20210801 IID50293 Nuclear receptor-binding factor 2 Mus musculus 287 Q8VCQ3 Q9DCG3 May modulate transcriptional activation by target nuclear receptors. Can act as transcriptional activator (in vitro) (By similarity). Involved in starvation-induced autophagy probably by its association with PI3K complex I (PI3KC3-C1). However, effects has been described variably. Involved in the induction of starvation-induced autophagy (By similarity). Stabilzes PI3KC3-C1 assembly and enhances ATG14-linked lipid kinase activity of PIK3C3 (PubMed:24849286). Proposed to negatively regulate basal and starvation-induced autophagy and to inhibit PIK3C3 activity by modulating interactions in PI3KC3-C1 (By similarity). May be involved in autophagosome biogenesis (By similarity). May play a role in neural progenitor cell survival during differentiation (PubMed:18619852). Involved in the induction of starvation-induced autophagy. Modulates ATG14-linked lipid kinase activity of PIK3C3 and stabilzes PI3K complex I (PI3KC3-C1) assembly (PubMed:24849286). May play a role in neural progenitor cell survival during differentiation (PubMed:18619852). Nuclear receptor interaction motif 141 145 Phosphoserine 112 112 Phosphoserine 268 268 Nrbf2 NRBF2_MOUSE MEVMEGPLNLAHQQSRRADRLLAAGKYEEAISCHRKATTYLSEAMKLTESEQAHLSLELQRDSHMKQLLLIQERWKRAKREERLKAQQSTERDGAPHLQAPPRPSEDAEGQSPLLSQPYIPSTERRLPEVQGVFDRDPDTLLFLLQQKNEPSEPCIGSKAPKDDKTIIEEQATKIADLKRHVEFLVAENERLRKENKQLKAEKARLLKGTAEKELDVDADFVEKSELWGLPSHSESAAASSTWQKFAANTGKAKDIPIPNLPPLDFPSPELPLMELSEDILKGFMND 2 2crbA 4 87 order 1 1 2crb NMR T.SUETAKE,F.HAYASHI,S.YOKOYAMA TO BE PUBLISHED nmr 2crb A 4 87 98 0 1 2crb 3515 Monomer monomer 2crbA Q8VCQ3 IID50293 4-90,137-148,161-210,257-257,259-263,265-265 1-3,91-136,149-160,211-256,258-258,264-264,266-287 6-80,162-216,259-287 1-5,81-161,217-258 81-86,114-117,125-145,154-161,217-232,246-258