20210801 20180803 20180228 20210801 IID50322 Dynein light chain 1, cytoplasmic 8 kDa dynein light chain Dynein light chain LC8-type 1 Protein inhibitor of neuronal nitric oxide synthase Rattus norvegicus 89 P63170 Q15701 Acts as one of several non-catalytic accessory components of the cytoplasmic dynein 1 complex that are thought to be involved in linking dynein to cargos and to adapter proteins that regulate dynein function. Cytoplasmic dynein 1 acts as a motor for the intracellular retrograde motility of vesicles and organelles along microtubules. May play a role in changing or maintaining the spatial distribution of cytoskeletal structures. Binds and inhibits the catalytic activity of neuronal nitric oxide synthase. Promotes transactivation functions of ESR1 and plays a role in the nuclear localization of ESR1. Regulates apoptotic activities of BCL2L11 by sequestering it to microtubules. Upon apoptotic stimuli the BCL2L11-DYNLL1 complex dissociates from cytoplasmic dynein and translocates to mitochondria and sequesters BCL2 thus neutralizing its antiapoptotic activity (By similarity). 0 0 N6-acetyllysine 36 36 Phosphoserine 88 88 Dynll1 DYL1_RAT MCDRKAVIKNADMSEEMQQDSVECATQALEKYNIEKDIAAHIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG 1 1f95A 1 89 order 1 2 1f95B 1 89 order 1 3 1f96A 1 89 order 2 4 1f96B 1 89 order 2 5 1f3cA 1 89 order 3 6 1f3cB 1 89 order 3 1 1f95 NMR 11178896 J.FAN,Q.ZHANG,H.TOCHIO,M.LI,M.ZHANG 2001 J.MOL.BIOL. 306 97 nmr 1f95 A 1 89 100 0 nmr 1f95 B 1 89 100 0 1 1f95_1 2110 Hetero tetramer 1f95D O43521 IID00746 1f95C O43521 IID00746 1f95B P63170 IID50322 1f95A P63170 IID50322 1f95B-1f95A 1f95C-1f95B 1f95D-1f95B 1f95D-1f95A 1f95C-1f95A 2 1f96 NMR 11178896 J.FAN,Q.ZHANG,H.TOCHIO,M.LI,M.ZHANG 2001 J.MOL.BIOL. 306 97 nmr 1f96 A 1 89 100 0 nmr 1f96 B 1 89 100 0 1 1f96 4566 Hetero tetramer 1f96A P63170 IID50322 1f96B P63170 IID50322 1f96B-1f96A 3 1f3c NMR 11178896 J.FAN,Q.ZHANG,H.TOCHIO,M.LI,M.ZHANG 2001 J.MOL.BIOL. 306 97 nmr 1f3c A 1 89 100 0 nmr 1f3c B 1 89 100 0 1 1f3c 1709 Homo dimer 1f3cB P63170 IID50322 1f3cA P63170 IID50322 1f3cB-1f3cA 4-89 1-3 1-89