20250201 IID50369 Multivesicular body sorting factor 12 12 kDa multivesicular body sorting factor ESCRT-I complex subunit MVB12 Saccharomyces cerevisiae (strain ATCC 204508 / S288c) 101 P42939 D6VUY9 Component of the ESCRT-I complex, a regulator of vesicular trafficking process. Binds to ubiquitinated cargo proteins and is required for the sorting of endocytic ubiquitinated cargos into multivesicular bodies (MVBs). Appears to be involved in cargo sorting and release of the ESCRT-I complex from the MVBs. 0 0 N-acetylmethionine 1 1 Phosphoserine 94 94 MVB12 Multivesicular body sorting fact MNNNVEELLRRIPLYNKYGKDFPQETVTRFQMPEFKLPALQPTRDLLCPWYEECDNITKVCQLHDSSNKKFDQWYKEQYLSKKPPGIVGNTLLSPSRKDNS 1 2p22D 4 81 order 1 1 2p22 X-RAY 294K 4.0) 17442384 M.S.KOSTELANSKY,C.SCHLUTER,Y.Y.TAM,S.LEE,R.GHIRLANDO,B.BEACH,E.CONIBEAR,J.H.HURLEY MOLECULAR ARCHITECTURE AND FUNCTIONAL MODEL OF THE COMPLETE YEAST ESCRT-I HETEROTETRAMER. 2007 CELL(CAMBRIDGE,MASS.) 129 485 x-ray 2p22 D 4 81 100 0 1 2p22_1 3752 Hetero tetramer 2p22B Q02767 IID50383 2p22A P25604 IID50362 2p22D P42939 IID50369 2p22C Q99176 IID50403 2p22A-2p22D 2p22B-2p22A 2p22A-2p22C 2p22B-2p22D 2p22D-2p22C
P25604-1 STP22/VPS27 Crystal structure of the yeast vps23 UEV domain in complex with a vps27 PSDP peptide Q04272-1 VPS20 ESCRT-III recruitment Q06696-1 VPS36/SNF8/VPS25/VPS25 The crystal structure of endosomal complex ESCRT-II (VPS22/VPS25/VPS36) 3-81 1-2,82-101 4-92 1-3,93-101 93-98