20250201 IID50389 Vacuolar-sorting protein SNF8 ESCRT-II complex subunit VPS22 Vacuolar protein-sorting-associated protein 22 Saccharomyces cerevisiae (strain ATCC 204508 / S288c) 233 Q12483 D6W410 Component of the endosomal sorting complex required for transport II (ESCRT-II), which is required for multivesicular body (MVB) formation and sorting of endosomal cargo proteins into MVBs. The MVB pathway mediates delivery of transmembrane proteins into the lumen of the lysosome for degradation. The ESCRT-II complex is probably involved in the recruitment of the ESCRT-III complex. 0 0 0 0 SNF8 Vacuolar-sorting protein SNF8 MKQFGLAAFDELKDGKYNDVNKTILEKQSVELRDQLMVFQERLVEFAKKHNSELQASPEFRSKFMHMCSSIGIDPLSLFDRDKHLFTVNDFYYEVCLKVIEICRQTKDMNGGVISFQELEKVHFRKLNVGLDDLEKSIDMLKSLECFEIFQIRGKKFLRSVPNELTSDQTKILEICSILGYSSISLLKANLGWEAVRSKSALDEMVANGLLWIDYQGGAEALYWDPSWITRQL 1 1u5tA 1 19 disorder 1 2 1u5tA 20 232 order 1 3 1u5tA 233 233 disorder 1 4 1w7pA 1 19 disorder 2 5 1w7pA 20 232 order 2 6 1w7pA 233 233 disorder 2 1 1u5t X-RAY 298.0K 7.4 15329733 A.HIERRO,J.SUN,A.S.RUSNAK,J.KIM,G.PRAG,S.D.EMR,J.H.HURLEY 2004 NATURE 431 221 x-ray 1u5t A 1 233 100 2 1 19 233 233 1 1u5t_1 2023 Hetero tetramer 1u5tA Q12483 IID50389 1u5tD P47142 IID50371 1u5tC P47142 IID50371 1u5tB Q06696 IID50387 1u5tC-1u5tB 1u5tD-1u5tB 1u5tA-1u5tB 1u5tA-1u5tD 1u5tA-1u5tC 2 1w7p X-RAY 8.5 15469844 H.TEO,O.PERISIC,B.GONZALEZ,R.L.WILLIAMS 2004 DEV.CELL 7 559 x-ray 1w7p A 1 233 100 2 1 19 233 233 1 1w7p_1 2023 Hetero tetramer 1w7pA Q12483 IID50389 1w7pC P47142 IID50371 1w7pB P47142 IID50371 1w7pD Q06696 IID50387 1w7pC-1w7pD 1w7pB-1w7pD 1w7pA-1w7pD 1w7pA-1w7pC 1w7pA-1w7pB

Q04272-1 VPS20 Q06696-1 VPS36/SNF8/VPS25/VPS25 4-4,7-7,9-54,56-73,90-229 1-3,5-6,8-8,55-55,74-89,230-233 16-233 1-15 1-15