20210801 20180803 20171122 20210801 IID90022 Protein Nef 3'ORF Negative factor Simian immunodeficiency virus (isolate 1A11) 263 P31818 Interferes with TCR signaling from the cell membrane. Interacts with CD247/TCRZ (TCR zeta chain) and exert potent down-regulation of cell surface TCR/CD3 complexes. 0 0 0 0 MGGTISMRRSRSTGDLRQRLLRARGETYERLLGEVEDGSSQSLGELDKGLSSLSCEGQKYNQEQYMNTPWRNPAEEREKLAYRKQNMDDIDEEDDDLVGDTVRPKVPLRTMSYKLAIDMSHFIKEKGGLEGIYYSARRHRILDIYLEKEEGIIPDWQDYTSGPGIRYPKTFGWLWKLVPVNVSDEAQEDEEHYLMHPAQTSQWDDPWGEVPAWKFDPTLAYTYEAYVRYPEEFGSKSGLSEEEVRRRLTARGLLNMADKKETR 1 3ik5A 95 99 disorder 1 2 3ik5A 100 180 order 1 3 3ik5A 181 196 disorder 1 4 3ik5A 197 234 order 1 5 3ik5A 235 235 disorder 1 6 3ik5C 95 99 disorder 1 7 3ik5C 100 181 order 1 8 3ik5C 182 199 disorder 1 9 3ik5C 200 234 order 1 10 3ik5C 235 235 disorder 1 1 3ik5 X-RAY 277K 7.5 20124696 W.M.KIM,A.B.SIGALOV,L.J.STERN PSEUDO-MEROHEDRAL TWINNING AND NONCRYSTALLOGRAPHIC SYMMETRY IN ORTHORHOMBIC CRYSTALS OF SIVMAC239 NEF CORE DOMAIN BOUND TO DIFFERENT-LENGTH TCRZETA FRAGMENTS. 2010 ACTA CRYSTALLOGR.,SECT.D 66 163 x-ray 3ik5 A 95 235 97 3 95 99 181 196 235 235 x-ray 3ik5 C 95 235 97 3 95 99 182 199 235 235 1 3ik5 3663 Hetero tetramer 3ik5D P20963 IID00544 3ik5B P20963 IID00544 3ik5C P31818 IID90022 3ik5A P31818 IID90022 3ik5D-3ik5C 3ik5B-3ik5A 3ik5C-3ik5A 6-83,101-234 1-5,84-100,235-263 3014 PF00469 2->234 1.6e-100 Negative factor, (F-Protein) or Nef hmm pfm 5284 1efnB_ 103->233 3.1e-63 hmm scp 7931 PF00469 2->231 8e-72 Negative factor, (F-Protein) or Nef rps pfm 10112 3reaA 90->231 9e-48 rps scp