20210801 20180803 20180425 20210801 IID90028 Ankyrin repeat domain-containing protein A238L p28 African swine fever virus 239 O36972 IkB-like protein that inhibits the binding of NF-kappa-B to DNA, thereby downregulating proinflammatory cytokine production (PubMed:8970976). Forms a heterodimer with the NF-kappa-B subunit RELA/p65 and prevents the activation of the NF-kappa-B transcription factor (By similarity). Inhibits calcineurin function, which is required for the induction of nuclear factor of activated T cells (NFAT)-dependent immune response genes (PubMed:23468591, PubMed:9677199). Prevents the binding of substrates to calcineurin without affecting the phosphatase activity (PubMed:23468591). Does not contain the serine residues that are phosphorylated by host IkB kinase and thus is not degraded following stimulation of the NFkB pathway (By similarity). 0 0 0 0 A238L IKBL_ASFM2 MDTIGLFSVEAEHLFVEWVKKCIKKGDLTLFETLFNADPWIVNRCNKNKITVFMLICIYGRLDFLRFLFKQESYPGEIVNHYRRDKDGNSAWHYLAEKNNHLLLEEVLDYFGKNGIRVCFPNFNGVTPIMKAAMRGRTLSVLSLLKYGANPNRKDYLKGFTTWDWAVFTGHADLVKTLNKGYQKPLFMHFPLYKLDVFHRRFKKKPKIIITGCEDNVYEKLPEQNSNFLCVKKLNKYGK 1 4f0zC 200 204 disorder 1 2 4f0zC 205 234 order 1 3 4f0zC 235 239 disorder 1 1 4f0z X-RAY 295K 23468591 S.GRIGORIU,R.BOND,P.COSSIO,J.A.CHEN,N.LY,G.HUMMER,R.PAGE,M.S.CYERT,W.PETI 2013 PLOS BIOL. 11 1492 x-ray 4f0z C 200 239 100 2 200 204 235 239 1 4f0z_1 2094 Hetero trimer 4f0zA Q08209 IID00069 4f0zB P63098 IID00060 4f0zC O36972 IID90028 4f0zB-4f0zC 4f0zA-4f0zB 4f0zA-4f0zC 8-71,78-113,119-179 1-7,72-77,114-118,180-239 7-239 1-6 1-6