20210801 20180803 20171025 20210801 IID90030 Protein Vpx Viral protein X X ORF protein Simian immunodeficiency virus (isolate PBj14/BCL-3) 112 P19508 Plays a role in nuclear translocation of the viral pre-integration complex (PIC), thus is required for the virus to infect non-dividing cells. Targets specific host proteins for degradation by the 26S proteasome. Acts by associating with the cellular CUL4A-DDB1 E3 ligase complex through direct interaction with host VPRPB/DCAF-1. This change in the E3 ligase substrate specificity results in the degradation of host SAMHD1. In turn, SAMHD1 depletion allows viral replication in host myeloid cells by preventing SAMHD1-mediated hydrolysis of intracellular dNTPs necessary for reverse transcription. Nuclear localization signal 65 72 0 0 vpx VPX_SIVSP MSDPRERIPPGNSGEETIGEAFDWLDRTVEEINRAAVNHLPRELIFQVWRRSWEYWHDEMGMSVSYTKYRYLCLIQKAMFMHCKKGCRCLGGEHGAGGWRPGPPPPPPPGLA 1 4cc9B 1 4 disorder 1 2 4cc9B 5 90 order 1 3 4cc9B 91 99 disorder 1 4 4cc9B 100 111 order 1 5 4cc9B 112 112 disorder 1 1 4cc9 X-RAY 7.5 24336198 D.SCHWEFEL,H.C.T.GROOM,V.C.BOUCHERIT,E.CHRISTODOULOU,P.A.WALKER,J.P.STOYE,K.N.BISHOP,I.A.TAYLOR STRUCTURAL BASIS OF LENTIVIRAL SUBVERSION OF A CELLULAR PROTEIN DEGRADATION PATHWAY. 2014 NATURE 505 234 x-ray 4cc9 B 1 112 100 3 1 4 91 99 112 112 1 4cc9_1 1937 Hetero trimer 4cc9A Q9Y4B6 IID00743 4cc9C Q9Y3Z3 4cc9B P19508 IID90030 4cc9C-4cc9B 4cc9A-4cc9B 4cc9A-4cc9C ProS 1 predicted 4 100 111 The unbound state of this region is predicted to be disordered by DICHOT and MobiDB. 2-8,17-89,106-112 1-1,9-16,90-105 19-91 1-18,92-112 13-18,92-100,109-112 101-110